User:SPage (WMF)/Api help test
{{Api help|query+extracts}} outputs {{Special:ApiHelp/query+extracts}} to transclude api.php help documentation into wiki pages.
Localization tests
[edit]See phab:T89768 about localization problems
Special:ApiHelp redirects to api.php?action=help. The latter has great i18n and improving l10n, e.g. https://www.mediawiki.org/w/api.php?action=help&modules=query%2Bextracts&uselang=fr
The problem for transcluding Special:ApiHelp into localized pages is how to indicate the desired language and then getting the uselang=LANG code to api.php?action=help.
Tests follow. I'm using uselang=es because someone has localized {{Api help}} into Spanish.
Raw inclusion
[edit]1. {{Special:ApiHelp?uselang=es}}
[edit]Result: This doesn't work, because Title?QueryParams is a valid page name.
Also, MediaWiki aggressively converts ?uselang=es into URL-encoded %3Fuselang%3Des, so the query parameter doesn't even look like a query parameter.
Result: The subpage handling is passed to Special:ApiHelp, but it doesn't detect the ?uselang=es as a parameter,
and so tries and fails to load the bogus module "query+extracts?uselang=es".
And again the $#@! URL-encoding.
My gerrit:191250 attempts to fix this, though the suggestion is use pipe-separated arguments (see elsewhere).
3. {{[[Special:ApiHelp|uselang=es]]}}
[edit]Result: I think the param gets passed the same way e.g. {{ Special:PrefixIndex/SomePage/ |hideredirects=1 |stripprefix=1 }} works but ApiHelp doesn't respond.
Main module
- Source: MediaWiki
- License: GPL-2.0-or-later
Specify the action to perform, the format of the response, and options that apply to all API modules.
- action
Which action to perform. This parameter should be sent as part of the request URL (not the POST body) for ease of use in debugging, analytics, and request routing or filtering.
- abusefiltercheckmatch
- Check to see if an AbuseFilter matches a set of variables, an edit, or a logged AbuseFilter event.
- abusefilterchecksyntax
- Check syntax of an AbuseFilter filter.
- abusefilterevalexpression
- Evaluates an AbuseFilter expression.
- abusefilterunblockautopromote
- Unblocks a user from receiving autopromotions due to an abusefilter consequence.
- abuselogprivatedetails
- View private details of an AbuseLog entry.
- acquiretempusername
- Acquire a temporary user username and stash it in the current session, if temp account creation is enabled and the current user is logged out. If a name has already been stashed, returns the same name.
- aggregategroups
- Manage aggregate message groups.
- antispoof
- Check a username against AntiSpoof's normalisation checks.
- block
- Block a user.
- centralauthtoken
- Fetch a centralauthtoken for making an authenticated request to an attached wiki.
- centralnoticecdncacheupdatebanner
- Request the purge of banner content stored in the CDN (front-end) cache for anonymous users, for the requested banner and language
- centralnoticechoicedata
- Get data needed to choose a banner for a given project and language
- centralnoticequerycampaign
- Get all configuration settings for a campaign.
- changeauthenticationdata
- Change authentication data for the current user.
- changecontentmodel
- Change the content model of a page
- checktoken
- Check the validity of a token from action=query&meta=tokens.
- clearhasmsg
- Clears the
hasmsgflag for the current user. - clientlogin
- Log in to the wiki using the interactive flow.
- communityconfigurationedit
- Change the content of a configuration provider in Community configuration
- compare
- Get the difference between two pages.
- createaccount
- Create a new user account.
- createlocalaccount
- Forcibly create a local account. The central account must exist.
- delete
- Delete a page.
- deleteglobalaccount
- Delete a global user.
- discouragetranslation
- Mark a translatable page as discouraged or not discouraged. Discouraged pages are hidden from the translation interface when searching for pages to translate, but can still be translated directly.
- discussiontoolsedit
- Post a message on a discussion page.
- discussiontoolsfindcomment
- Find a comment by its ID or name.
- discussiontoolsgetsubscriptions
- Get the subscription statuses of given topics.
- discussiontoolssubscribe
- Subscribe (or unsubscribe) to receive notifications about a topic.
- discussiontoolsthank
- Send a public thank-you notification for a comment.
- echocreateevent
- Manually trigger a notification to a user
- echomarkread
- Mark notifications as read for the current user.
- echomarkseen
- Mark notifications as seen for the current user.
- echomute
- Mute or unmute notifications from certain users or pages.
- edit
- Create and edit pages.
- editmassmessagelist
- Edit a mass message delivery list.
- emailuser
- Email a user.
- expandtemplates
- Expands all templates within wikitext.
- featuredfeed
- Returns a featured content feed.
- feedcontributions
- Returns a user's contributions feed.
- feedrecentchanges
- Returns a recent changes feed.
- feedthreads
- Return a feed of discussion threads.
- feedwatchlist
- Returns a watchlist feed.
- filerevert
- Revert a file to an old version.
- flow
- Allows actions to be taken on Structured Discussions pages.
- flow-parsoid-utils
- Convert text between wikitext and HTML.
- flowthank
- Send a public thank-you notification for a Flow comment.
- globalblock
- Globally block or unblock a user.
- globalpreferenceoverrides
- Change local overrides for global preferences for the current user.
- globalpreferences
- Change global preferences of the current user.
- globaluserrights
- Add/remove a user to/from global groups.
- groupreview
- Set message group workflow states.
- help
- Display help for the specified modules.
- imagerotate
- This module has been disabled.
- import
- Import a page from another wiki, or from an XML file.
- jsonconfig
- Allows direct access to JsonConfig subsystem.
- languagesearch
- Search for language names in any script.
- linkaccount
- Link an account from a third-party provider to the current user.
- login
- Log in and get authentication cookies.
- logout
- Log out and clear session data.
- managetags
- Perform management tasks relating to change tags.
- markfortranslation
- Mark a page for translation
- massmessage
- Send a message to a list of pages.
- mergehistory
- Merge page histories.
- move
- Move a page.
- newslettersubscribe
- Subscribe to or unsubscribe from a newsletter.
- opensearch
- Search the wiki using the OpenSearch protocol.
- options
- Change preferences of the current user.
- paraminfo
- Obtain information about API modules.
- parse
- Parses content and returns parser output.
- patrol
- Patrol a page or revision.
- protect
- Change the protection level of a page.
- purge
- Purge the cache for the given titles.
- query
- Fetch data from and about MediaWiki.
- removeauthenticationdata
- Remove authentication data for the current user.
- resetpassword
- Send a password reset email to a user.
- revisiondelete
- Delete and undelete revisions.
- rollback
- Undo the last edit to the page.
- rsd
- Export an RSD (Really Simple Discovery) schema.
- searchtranslations
- Search translations.
- setglobalaccountstatus
- Hide or lock (or unhide or unlock) a global user account.
- setnotificationtimestamp
- Update the notification timestamp for watched pages.
- setpagelanguage
- Change the language of a page.
- shortenurl
- Shorten a long URL into a shorter one.
- sitematrix
- Get Wikimedia sites list.
- spamblacklist
- Validate one or more URLs against the spam block list.
- streamconfigs
- Exposes event stream config. Returns only format=json with formatversion=2.
- strikevote
- Allows admins to strike or unstrike a vote.
- tag
- Add or remove change tags from individual revisions or log entries.
- templatedata
- Fetch data stored by the TemplateData extension.
- thank
- Send a thank-you notification to an editor.
- threadaction
- Allows actions to be taken on threads and posts in threaded discussions.
- titleblacklist
- Validate a page title, filename, or username against the TitleBlacklist.
- torblock
- Check if an IP address is blocked as a Tor exit node.
- transcodereset
- Users with the 'transcode-reset' right can reset and re-run a transcode job.
- translationaids
- Query all translations aids.
- translationreview
- Mark translations reviewed.
- translationstats
- Fetch translation statistics
- ttmserver
- Query suggestions from translation memories.
- unblock
- Unblock a user.
- undelete
- Undelete revisions of a deleted page.
- unlinkaccount
- Remove a linked third-party account from the current user.
- upload
- Upload a file, or get the status of pending uploads.
- userrights
- Change a user's group membership.
- validatepassword
- Validate a password against the wiki's password policies.
- watch
- Add or remove pages from the current user's watchlist.
- webapp-manifest
- Returns a webapp manifest.
- webauthn
- API Module to communicate between server and client during registration/authentication process.
- wikilove
- Give WikiLove to another user.
- bouncehandler
- Internal. Receive a bounce email and process it to handle the failing recipient.
- categorytree
- Internal. Internal module for the CategoryTree extension.
- chartinfo
- Internal. Retrieve current count of how many unique Chart page usages there are. Multiple uses of the same chart on the same page are considered a single use.
- cirrus-check-sanity
- Internal. Reports on the correctness of a range of page ids in the search index
- cirrus-config-dump
- Internal. Dump of CirrusSearch configuration.
- cirrus-profiles-dump
- Internal. Dump of CirrusSearch profiles for this wiki.
- cirrus-schema-dump
- Internal. Dump of CirrusSearch schema (settings and mappings) for this wiki.
- codemirror-validate
- Internal. Check for validation errors in the given content
- collection
- Internal. API module for performing various operations on a wiki user's collection.
- cspreport
- Internal. Used by browsers to report violations of the Content Security Policy. This module should never be used, except when used automatically by a CSP compliant web browser.
- discussiontoolscompare
- Internal. Get information about comment changes between two page revisions.
- discussiontoolspageinfo
- Internal. Returns metadata required to initialize the discussion tools.
- discussiontoolspreview
- Internal. Preview a message on a discussion page.
- editcheckreferenceurl
- Internal. Check the status of a URL for use as a reference.
- fancycaptchareload
- Internal. Get a new FancyCaptcha.
- focusareaedit
- Internal. Create or update a focus area in the Community Wishlist.
- jsondata
- Internal. Retrieve localized JSON data.
- jsontransform
- Internal. Retrieve JSON data transformed by a Lua function.
- managegroupsynchronizationcache
- Internal. Manage group synchronization cache.
- managemessagegroups
- Internal. Add a message as a rename of an existing message or a new message in the group during imports
- messagegroupsubscription
- Internal. Message group subscription related operations
- parser-migration
- Internal. Parse a page with two different parser configurations.
- readinglists
- Internal. Reading list write operations.
- sanitize-mapdata
- Internal. Performs data validation for Kartographer extension
- scribunto-console
- Internal. Internal module for servicing XHR requests from the Scribunto console.
- securepollauth
- Internal. Allows a remote wiki to authenticate users before granting access to vote in the election.
- stashedit
- Internal. Prepare an edit in shared cache.
- timedtext
- Internal. Provides timed text content for usage by <track> elements
- translationcheck
- Internal. Validate translations.
- translationentitysearch
- Internal. Search for message groups and messages
- ulslocalization
- Internal. Get the localization of ULS in the given language.
- ulssetlang
- Internal. Update user's preferred interface language.
- visualeditor
- Internal. Returns HTML5 for a page from the Parsoid service.
- visualeditoredit
- Internal. Save an HTML5 page to MediaWiki (converted to wikitext via the Parsoid service).
- wikimediaeventsblockededit
- Internal. Log information about blocked edit attempts
- wikimediaeventshcaptchaeditattempt
- Internal. Log edit diff when hCaptcha challenge is shown but edit is incomplete
- wishedit
- Internal. Create or update a wish in the Community Wishlist.
- wishlistvote
- Internal. Support a wish or focus area in the Community Wishlist.
- One of the following values: abusefiltercheckmatch, abusefilterchecksyntax, abusefilterevalexpression, abusefilterunblockautopromote, abuselogprivatedetails, acquiretempusername, aggregategroups, antispoof, block, centralauthtoken, centralnoticecdncacheupdatebanner, centralnoticechoicedata, centralnoticequerycampaign, changeauthenticationdata, changecontentmodel, checktoken, clearhasmsg, clientlogin, communityconfigurationedit, compare, createaccount, createlocalaccount, delete, deleteglobalaccount, discouragetranslation, discussiontoolsedit, discussiontoolsfindcomment, discussiontoolsgetsubscriptions, discussiontoolssubscribe, discussiontoolsthank, echocreateevent, echomarkread, echomarkseen, echomute, edit, editmassmessagelist, emailuser, expandtemplates, featuredfeed, feedcontributions, feedrecentchanges, feedthreads, feedwatchlist, filerevert, flow-parsoid-utils, flow, flowthank, globalblock, globalpreferenceoverrides, globalpreferences, globaluserrights, groupreview, help, imagerotate, import, jsonconfig, languagesearch, linkaccount, login, logout, managetags, markfortranslation, massmessage, mergehistory, move, newslettersubscribe, opensearch, options, paraminfo, parse, patrol, protect, purge, query, removeauthenticationdata, resetpassword, revisiondelete, rollback, rsd, searchtranslations, setglobalaccountstatus, setnotificationtimestamp, setpagelanguage, shortenurl, sitematrix, spamblacklist, streamconfigs, strikevote, tag, templatedata, thank, threadaction, titleblacklist, torblock, transcodereset, translationaids, translationreview, translationstats, ttmserver, unblock, undelete, unlinkaccount, upload, userrights, validatepassword, watch, webapp-manifest, webauthn, wikilove, bouncehandler, categorytree, chartinfo, cirrus-check-sanity, cirrus-config-dump, cirrus-profiles-dump, cirrus-schema-dump, codemirror-validate, collection, cspreport, discussiontoolscompare, discussiontoolspageinfo, discussiontoolspreview, editcheckreferenceurl, fancycaptchareload, focusareaedit, jsondata, jsontransform, managegroupsynchronizationcache, managemessagegroups, messagegroupsubscription, parser-migration, readinglists, sanitize-mapdata, scribunto-console, securepollauth, stashedit, timedtext, translationcheck, translationentitysearch, ulslocalization, ulssetlang, visualeditor, visualeditoredit, wikimediaeventsblockededit, wikimediaeventshcaptchaeditattempt, wishedit, wishlistvote
- Default: help
- format
The format of the output.
- One of the following values: json, jsonfm, none, rawfm, xml, xmlfm
- Default: jsonfm
- maxlag
Maximum lag can be used when MediaWiki is installed on a database replicated cluster. To save actions causing any more site replication lag, this parameter can make the client wait until the replication lag is less than the specified value. In case of excessive lag, error code maxlag is returned with a message like Waiting for $host: $lag seconds lagged.
See Manual: Maxlag parameter for more information.- Type: integer
- smaxage
Set the
s-maxageHTTP cache control header to this many seconds. Errors are never cached.- Type: integer
- The value must be no less than 0.
- Default: 0
- maxage
Set the
max-ageHTTP cache control header to this many seconds. Errors are never cached.- Type: integer
- The value must be no less than 0.
- Default: 0
- assert
Verify that the user is logged in (including possibly as a temporary user) if set to user, not logged in if set to anon, or has the bot user right if bot.
- One of the following values: anon, bot, user
- assertuser
Verify the current user is the named user.
- Type: user, by any of username and Temporary user
- requestid
Any value given here will be included in the response. May be used to distinguish requests.
- servedby
Include the hostname that served the request in the results.
- Type: boolean (details)
- curtimestamp
Include the current timestamp in the result.
- Type: boolean (details)
- responselanginfo
Include the languages used for uselang and errorlang in the result.
- Type: boolean (details)
- origin
When accessing the API using a cross-domain AJAX request (CORS), set this to the originating domain. This must be included in any pre-flight request, and therefore must be part of the request URL (not the POST body).
For authenticated requests, this must match one of the origins in the
Originheader exactly, so it has to be set to something like https://en.wikipedia.org or https://meta.wikimedia.org. If this parameter does not match theOriginheader, a 403 response will be returned. If this parameter matches theOriginheader and the origin is allowed, theAccess-Control-Allow-OriginandAccess-Control-Allow-Credentialsheaders will be set.For non-authenticated requests, specify the value *. This will cause the
Access-Control-Allow-Originheader to be set, butAccess-Control-Allow-Credentialswill befalseand all user-specific data will be restricted.- crossorigin
When accessing the API using a cross-domain AJAX request (CORS) and using a session provider that is safe against cross-site request forgery (CSRF) attacks (such as OAuth), use this instead of
origin=*to make the request authenticated (i.e., not logged out). This must be included in any pre-flight request, and therefore must be part of the request URL (not the POST body).Note that most session providers, including standard cookie-based sessions, do not support authenticated CORS and cannot be used with this parameter.
- Type: boolean (details)
- uselang
Language to use for message translations. action=query&meta=siteinfo&siprop=languages returns a list of language codes. You can specify user to use the current user's language preference or content to use this wiki's content language.
- Default: user
- variant
Variant of the language. Only works if the base language supports variant conversion.
- errorformat
Format to use for warning and error text output
- plaintext
- Wikitext with HTML tags removed and entities replaced.
- wikitext
- Unparsed wikitext.
- html
- HTML
- raw
- Message key and parameters.
- none
- No text output, only the error codes.
- bc
- Format used prior to MediaWiki 1.29. errorlang and errorsuselocal are ignored.
- One of the following values: bc, html, none, plaintext, raw, wikitext
- Default: bc
- errorlang
Language to use for warnings and errors. action=query&meta=siteinfo&siprop=languages returns a list of language codes. Specify content to use this wiki's content language or uselang to use the same value as the uselang parameter.
- Default: uselang
- errorsuselocal
If given, error texts will use locally-customized messages from the MediaWiki namespace.
- Type: boolean (details)
- centralauthtoken
When accessing the API using a cross-domain AJAX request (CORS), use this to authenticate as the current SUL user. Use action=centralauthtoken on this wiki to retrieve the token, before making the CORS request. Each token may only be used once, and expires after 60 seconds. This should be included in any pre-flight request, and therefore should be included in the request URI (not the POST body).
On this wiki the expected value is a JSON Web Token, which may be validated by proxy servers in front of MediaWiki. If the token has expired or is otherwise invalid, you may receive a HTTP error from a proxy in a different format than a normal API error.
- Help for the main module.
- api.php?action=help [open in sandbox]
- All help in one page.
- api.php?action=help&recursivesubmodules=1&toc [open in sandbox]
4. {{[[Special:ApiHelp/query+extracts|uselang=es]]}}
[edit]Result: I think the param gets passed, but it's not parsed.
prop=extracts (ex)
- This module requires read rights.
- Source: TextExtracts
- License: GPL-2.0-or-later
Returns plain-text or limited HTML extracts of the given pages.
- exchars
How many characters to return. Actual text returned might be slightly longer.
- Type: integer
- The value must be between 1 and 1,200.
- exsentences
How many sentences to return.
- Type: integer
- The value must be between 1 and 10.
- exlimit
How many extracts to return. (Multiple extracts can only be returned if exintro is set to true.)
- Type: integer or max
- The value must be between 1 and 20.
- Default: 20
- exintro
Return only content before the first section.
- Type: boolean (details)
- explaintext
Return extracts as plain text instead of limited HTML.
- Type: boolean (details)
- exsectionformat
How to format sections in plaintext mode:
- plain
- No formatting.
- wiki
- Wikitext-style formatting (== like this ==).
- raw
- This module's internal representation (section titles prefixed with <ASCII 1><ASCII 2><section level><ASCII 2><ASCII 1>).
- One of the following values: plain, raw, wiki
- Default: wiki
- excontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Type: integer
- Get a 175-character extract
- api.php?action=query&prop=extracts&exchars=175&titles=Therion [open in sandbox]
using template
[edit]Either {{Api help}} needs a lang parameter, or the localized version {{Api help/es}} needs to modify the transclusion.
Invoke the localized subpage: {{Api help/es|query+extracts}}
[edit]This works but we need a way to pass the language to the transclusion (tests above).
Should callers be using {{TNTN}}, does that call the localized template automatically?
| La siguiente documentación es la salida de Special: |
prop=extracts (ex)
- This module requires read rights.
- Source: TextExtracts
- License: GPL-2.0-or-later
Returns plain-text or limited HTML extracts of the given pages.
- exchars
How many characters to return. Actual text returned might be slightly longer.
- Type: integer
- The value must be between 1 and 1,200.
- exsentences
How many sentences to return.
- Type: integer
- The value must be between 1 and 10.
- exlimit
How many extracts to return. (Multiple extracts can only be returned if exintro is set to true.)
- Type: integer or max
- The value must be between 1 and 20.
- Default: 20
- exintro
Return only content before the first section.
- Type: boolean (details)
- explaintext
Return extracts as plain text instead of limited HTML.
- Type: boolean (details)
- exsectionformat
How to format sections in plaintext mode:
- plain
- No formatting.
- wiki
- Wikitext-style formatting (== like this ==).
- raw
- This module's internal representation (section titles prefixed with <ASCII 1><ASCII 2><section level><ASCII 2><ASCII 1>).
- One of the following values: plain, raw, wiki
- Default: wiki
- excontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Type: integer
- Get a 175-character extract
- api.php?action=query&prop=extracts&exchars=175&titles=Therion [open in sandbox]
In Engish
[edit]Template works fine in English
| The following documentation is the output of Special: |
prop=extracts (ex)
- This module requires read rights.
- Source: TextExtracts
- License: GPL-2.0-or-later
Returns plain-text or limited HTML extracts of the given pages.
- exchars
How many characters to return. Actual text returned might be slightly longer.
- Type: integer
- The value must be between 1 and 1,200.
- exsentences
How many sentences to return.
- Type: integer
- The value must be between 1 and 10.
- exlimit
How many extracts to return. (Multiple extracts can only be returned if exintro is set to true.)
- Type: integer or max
- The value must be between 1 and 20.
- Default: 20
- exintro
Return only content before the first section.
- Type: boolean (details)
- explaintext
Return extracts as plain text instead of limited HTML.
- Type: boolean (details)
- exsectionformat
How to format sections in plaintext mode:
- plain
- No formatting.
- wiki
- Wikitext-style formatting (== like this ==).
- raw
- This module's internal representation (section titles prefixed with <ASCII 1><ASCII 2><section level><ASCII 2><ASCII 1>).
- One of the following values: plain, raw, wiki
- Default: wiki
- excontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Type: integer
- Get a 175-character extract
- api.php?action=query&prop=extracts&exchars=175&titles=Therion [open in sandbox]
Api help| query
[edit]| The following documentation is the output of Special: |
action=query
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Fetch data from and about MediaWiki.
All data modifications will first have to use query to acquire a token to prevent abuse from malicious sites.
- prop
Which properties to get for the queried pages.
- categories
- List all categories the pages belong to.
- categoryinfo
- Returns information about the given categories.
- contributors
- Get the list of registered contributors (including temporary users) and the count of anonymous contributors to a page.
- deletedrevisions
- Get deleted revision information.
- duplicatefiles
- List all files that are duplicates of the given files based on hash values.
- extlinks
- Returns all external URLs (not interwikis) from the given pages.
- extracts
- Returns plain-text or limited HTML extracts of the given pages.
- fileusage
- Find all pages that use the given files.
- globalusage
- Returns global image usage for a certain image.
- imageinfo
- Returns file information and upload history.
- images
- Returns all files contained on the given pages.
- info
- Get basic page information.
- iwlinks
- Returns all interwiki links from the given pages.
- langlinks
- Returns all interlanguage links from the given pages.
- links
- Returns all links from the given pages.
- linkshere
- Find all pages that link to the given pages.
- mmcontent
- Get the description and targets of a spamlist
- pageimages
- Returns information about images on the page, such as thumbnail and presence of photos.
- pageprops
- Get various page properties defined in the page content.
- pageterms
- Get the Wikidata terms (typically labels, descriptions and aliases) associated with a page via a sitelink.
- pageviews
- Shows per-page pageview data (the number of daily pageviews for each of the last pvipdays days).
- redirects
- Returns all redirects to the given pages.
- revisions
- Get revision information.
- stashimageinfo
- Returns file information for stashed files.
- templates
- Returns all pages transcluded on the given pages.
- transcludedin
- Find all pages that transclude the given pages.
- transcodestatus
- Get transcode status for a given file page.
- videoinfo
- Extends imageinfo to include video source (derivatives) information
- wbentityusage
- Returns all entity IDs used in the given pages.
- flowinfo
- Deprecated. Get basic Structured Discussions information about a page.
- cirrusbuilddoc
- Internal. Dump of a CirrusSearch article document from the database servers
- cirruscompsuggestbuilddoc
- Internal. Dump of the document used by the completion suggester
- cirrusdoc
- Internal. Dump of a CirrusSearch article document from the search servers
- description
- Internal. Get a short description a.k.a. subtitle explaining what the target page is about.
- mapdata
- Internal. Request all Kartographer map data for the given pages
- Values (separate with | or alternative): categories, categoryinfo, contributors, deletedrevisions, duplicatefiles, extlinks, extracts, fileusage, globalusage, imageinfo, images, info, iwlinks, langlinks, links, linkshere, mmcontent, pageimages, pageprops, pageterms, pageviews, redirects, revisions, stashimageinfo, templates, transcludedin, transcodestatus, videoinfo, wbentityusage, flowinfo, cirrusbuilddoc, cirruscompsuggestbuilddoc, cirrusdoc, description, mapdata
- list
Which lists to get.
- abusefilters
- Show details of the abuse filters.
- abuselog
- Show events that were caught by one of the abuse filters.
- allcategories
- Enumerate all categories.
- alldeletedrevisions
- List all deleted revisions by a user or in a namespace.
- allfileusages
- List all file usages, including non-existing.
- allimages
- Enumerate all images sequentially.
- alllinks
- Enumerate all links that point to a given namespace.
- allpages
- Enumerate all pages sequentially in a given namespace.
- allredirects
- List all redirects to a namespace.
- allrevisions
- List all revisions.
- alltransclusions
- List all transclusions (pages embedded using {{x}}), including non-existing.
- allusers
- Enumerate all registered users.
- backlinks
- Find all pages that link to the given page.
- betafeatures
- List all BetaFeatures
- blocks
- List all blocked users and IP addresses.
- categorymembers
- List all pages in a given category.
- centralnoticeactivecampaigns
- Get a list of currently active campaigns with start and end dates and associated banners.
- centralnoticelogs
- Get a log of campaign configuration changes.
- checkuserlog
- Get entries from the CheckUser log.
- codexicons
- Get Codex icons
- communityrequests-wishes
- Get a list of wishes from the Community Wishlist.
- embeddedin
- Find all pages that embed (transclude) the given title.
- extdistrepos
- Returns the list of repositories supported by ExtensionDistributor
- exturlusage
- Enumerate pages that contain a given URL.
- filearchive
- Enumerate all deleted files sequentially.
- gadgetcategories
- Returns a list of gadget sections.
- gadgets
- Returns a list of gadgets used on this wiki.
- globalallusers
- Enumerate all global users.
- globalblocks
- List all globally blocked IP addresses and accounts. Note: Users that are locked using CentralAuth are not included in this list unless also globally blocked.
- globalgroups
- Enumerate all global groups.
- globalrenamequeue
- List requests in the global rename queue.
- globalusers
- Get information about a list of global users.
- imageusage
- Find all pages that use the given image title.
- iwbacklinks
- Find all pages that link to the given interwiki link.
- langbacklinks
- Find all pages that link to the given language link.
- linterrors
- Get a list of lint errors
- logevents
- Get events from logs.
- messagecollection
- Query MessageCollection about translations.
- mostviewed
- Lists the most viewed pages (based on last day's pageview count).
- mystashedfiles
- Get a list of files in the current user's upload stash.
- pagecollectionsmetadata
- Fetch page collection information for the given title.
- pagepropnames
- List all page property names in use on the wiki.
- pageswithprop
- List all pages using a given page property.
- prefixsearch
- Perform a prefix search for page titles.
- protectedtitles
- List all titles protected from creation.
- querypage
- Get a list provided by a QueryPage-based special page.
- random
- Get a set of random pages.
- recentchanges
- Enumerate recent changes.
- search
- Perform a full text search.
- tags
- List change tags.
- threads
- Show details of LiquidThreads threads.
- trackingcategories
- Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
- usercontribs
- Get all edits by a user.
- users
- Get information about a list of users.
- watchlist
- Get recent changes to pages in the current user's watchlist.
- watchlistraw
- Get all pages on the current user's watchlist.
- wblistentityusage
- Returns all pages that use the given entity IDs.
- wikisets
- Enumerate all wiki sets.
- checkuser
- Deprecated. This API has been disabled by the site administrators. Querying the API will return no data. Check which IP addresses are used by a given username or which usernames are used by a given IP address.
- deletedrevs
- Deprecated. list=deletedrevs has been deprecated. Please use prop=deletedrevisions or list=alldeletedrevisions instead.List deleted revisions.
- extdistbranches
- Internal. Returns the list of branches for a repository supported by ExtensionDistributor
- messagegroupsubscription
- Internal. List message groups the current user is subscribed to.
- readinglistentries
- Internal. List the pages of a certain list.
- Values (separate with | or alternative): abusefilters, abuselog, allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, allusers, backlinks, betafeatures, blocks, categorymembers, centralnoticeactivecampaigns, centralnoticelogs, checkuserlog, codexicons, communityrequests-wishes, embeddedin, extdistrepos, exturlusage, filearchive, gadgetcategories, gadgets, globalallusers, globalblocks, globalgroups, globalrenamequeue, globalusers, imageusage, iwbacklinks, langbacklinks, linterrors, logevents, messagecollection, mostviewed, mystashedfiles, pagecollectionsmetadata, pagepropnames, pageswithprop, prefixsearch, protectedtitles, querypage, random, recentchanges, search, tags, threads, trackingcategories, usercontribs, users, watchlist, watchlistraw, wblistentityusage, wikisets, checkuser, deletedrevs, extdistbranches, messagegroupsubscription, readinglistentries
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- meta
Which metadata to get.
- allmessages
- Return messages from this site.
- authmanagerinfo
- Retrieve information about the current authentication status.
- babel
- Get information about what languages the user knows
- communityconfiguration
- Read the community configuration
- featureusage
- Get a summary of logged API feature usages for a user agent.
- filerepoinfo
- Return meta information about image repositories configured on the wiki.
- globalpreferences
- Retrieve global preferences for the current user.
- globalrenamestatus
- Show information about global renames that are in progress.
- globaluserinfo
- Show information about a global user.
- languageinfo
- Return information about available languages.
- languagestats
- Query language stats.
- linterstats
- Get number of lint errors in each category
- managemessagegroups
- Fetch possible renames for a message in a group during imports
- messagegroups
- Return information about message groups.
- messagegroupstats
- Query message group stats.
- messagetranslations
- Query all translations for a single message.
- notifications
- Get notifications waiting for the current user.
- siteinfo
- Return general information about the site.
- siteviews
- Shows sitewide pageview data (daily pageview totals for each of the last pvisdays days).
- tokens
- Gets tokens for data-modifying actions.
- unreadnotificationpages
- Get pages for which there are unread notifications for the current user.
- userinfo
- Get information about the current user.
- wikibase
- Get information about the Wikibase client and the associated Wikibase repository.
- checkuserformattedblockinfo
- Internal. Return formatted block details for sitewide blocks affecting the current user.
- readinglists
- Internal. List or filter the user's reading lists and show metadata about them.
- Values (separate with | or alternative): allmessages, authmanagerinfo, babel, communityconfiguration, featureusage, filerepoinfo, globalpreferences, globalrenamestatus, globaluserinfo, languageinfo, languagestats, linterstats, managemessagegroups, messagegroups, messagegroupstats, messagetranslations, notifications, siteinfo, siteviews, tokens, unreadnotificationpages, userinfo, wikibase, checkuserformattedblockinfo, readinglists
- indexpageids
Include an additional pageids section listing all returned page IDs.
- Type: boolean (details)
- export
Export the current revisions of all given or generated pages.
- Type: boolean (details)
- exportnowrap
Return the export XML without wrapping it in an XML result (same format as Special:Export). Can only be used with query+export.
- Type: boolean (details)
- exportschema
Target the given version of the XML dump format when exporting. Can only be used with query+export.
- One of the following values: 0.10, 0.11
- Default: 0.11
- iwurl
Whether to get the full URL if the title is an interwiki link.
- Type: boolean (details)
- continue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- rawcontinue
Return raw query-continue data for continuation.
- Type: boolean (details)
- titles
A list of titles to work on.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- pageids
A list of page IDs to work on.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- revids
A list of revision IDs to work on. Note that almost all query modules will convert revision IDs to the corresponding page ID and work on the latest revision instead. Only prop=revisions uses exact revisions for its response.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- generator
Get the list of pages to work on by executing the specified query module.
Note: Generator parameter names must be prefixed with a "g", see examples.
- allcategories
- Enumerate all categories.
- alldeletedrevisions
- List all deleted revisions by a user or in a namespace.
- allfileusages
- List all file usages, including non-existing.
- allimages
- Enumerate all images sequentially.
- alllinks
- Enumerate all links that point to a given namespace.
- allpages
- Enumerate all pages sequentially in a given namespace.
- allredirects
- List all redirects to a namespace.
- allrevisions
- List all revisions.
- alltransclusions
- List all transclusions (pages embedded using {{x}}), including non-existing.
- backlinks
- Find all pages that link to the given page.
- categories
- List all categories the pages belong to.
- categorymembers
- List all pages in a given category.
- deletedrevisions
- Get deleted revision information.
- duplicatefiles
- List all files that are duplicates of the given files based on hash values.
- embeddedin
- Find all pages that embed (transclude) the given title.
- exturlusage
- Enumerate pages that contain a given URL.
- fileusage
- Find all pages that use the given files.
- images
- Returns all files contained on the given pages.
- imageusage
- Find all pages that use the given image title.
- iwbacklinks
- Find all pages that link to the given interwiki link.
- langbacklinks
- Find all pages that link to the given language link.
- links
- Returns all links from the given pages.
- linkshere
- Find all pages that link to the given pages.
- messagecollection
- Query MessageCollection about translations.
- mostviewed
- Lists the most viewed pages (based on last day's pageview count).
- pageswithprop
- List all pages using a given page property.
- prefixsearch
- Perform a prefix search for page titles.
- protectedtitles
- List all titles protected from creation.
- querypage
- Get a list provided by a QueryPage-based special page.
- random
- Get a set of random pages.
- recentchanges
- Enumerate recent changes.
- redirects
- Returns all redirects to the given pages.
- revisions
- Get revision information.
- search
- Perform a full text search.
- templates
- Returns all pages transcluded on the given pages.
- trackingcategories
- Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
- transcludedin
- Find all pages that transclude the given pages.
- watchlist
- Get recent changes to pages in the current user's watchlist.
- watchlistraw
- Get all pages on the current user's watchlist.
- wblistentityusage
- Returns all pages that use the given entity IDs.
- readinglistentries
- Internal. List the pages of a certain list.
- One of the following values: allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, backlinks, categories, categorymembers, deletedrevisions, duplicatefiles, embeddedin, exturlusage, fileusage, images, imageusage, iwbacklinks, langbacklinks, links, linkshere, messagecollection, mostviewed, pageswithprop, prefixsearch, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, templates, trackingcategories, transcludedin, watchlist, watchlistraw, wblistentityusage, readinglistentries
- redirects
Automatically resolve redirects in query+titles, query+pageids, and query+revids, and in pages returned by query+generator.
- Type: boolean (details)
- converttitles
Convert titles to other variants if necessary. Only works if the wiki's content language supports variant conversion. Languages that support variant conversion include ban, crh, en, gan, iu, ku, mni, sh, shi, sr, tg, tly, uz, wuu, zgh and zh.
- Type: boolean (details)
- Fetch site info and revisions of MediaWiki.
- api.php?action=query&prop=revisions&meta=siteinfo&titles=MediaWiki&rvprop=user|comment&continue= [open in sandbox]
- Fetch revisions of pages beginning with API/.
- api.php?action=query&generator=allpages&gapprefix=API/&prop=revisions&continue= [open in sandbox]